PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G010700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 288aa    MW: 32351.8 Da    PI: 8.0587
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G010700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.71.6e-51111371128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         +ppGfrFhP+deelv +yL +k++g +  +  +i +vd++k+ePwdLp ++  + kewy +s rd+kyatg+r+nrat+sgyWkatgkd++
  Brast03G010700.1.p  11 MPPGFRFHPRDEELVLDYLLHKLTGGHGGAGVAIVDVDLNKCEPWDLPDAACVGGKEWYLYSLRDRKYATGHRTNRATQSGYWKATGKDRP 101
                         79*************************888667***************7666789************************************ PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         + +  ++lvg++ktLvfy+grapkg++t+Wvmhe+rl
  Brast03G010700.1.p 102 IRR-CRQLVGMRKTLVFYQGRAPKGTRTEWVMHEFRL 137
                         **9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-593172IPR003441NAC domain
PROSITE profilePS5100555.19211172IPR003441NAC domain
PfamPF023652.1E-2412137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MSYIGMMEAR MPPGFRFHPR DEELVLDYLL HKLTGGHGGA GVAIVDVDLN KCEPWDLPDA  60
ACVGGKEWYL YSLRDRKYAT GHRTNRATQS GYWKATGKDR PIRRCRQLVG MRKTLVFYQG  120
RAPKGTRTEW VMHEFRLIQQ QQDPLLHDQQ PHARSSCSDL KEDWVLCRVF YKSRTTPRPP  180
SEEACTFSSE LGLQAAPPLA PLIDAYIAFE GGTTMTAVEQ VNCFSGLQAL PFKGSVSFGD  240
LLGWDDPEKK AIRTALSNMP SSNSNSKLEL PPNWSQENAL SQMWTPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-49617815174NAC domain-containing protein 19
3swp_C1e-49617815174NAC domain-containing protein 19
3swp_B1e-49617815174NAC domain-containing protein 19
3swp_A1e-49617815174NAC domain-containing protein 19
3swm_D1e-49617815174NAC domain-containing protein 19
3swm_C1e-49617815174NAC domain-containing protein 19
3swm_B1e-49617815174NAC domain-containing protein 19
3swm_A1e-49617815174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573507.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE69e-76NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A0Q3JAX30.0A0A0Q3JAX3_BRADI; Uncharacterized protein
STRINGBRADI3G17287.11e-178(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101237138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.24e-73NAC domain containing protein 1